Protein Info for Atu1677 in Agrobacterium fabrum C58

Annotation: queuine tRNA-ribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 TIGR00430: tRNA-guanine transglycosylase" amino acids 7 to 366 (360 residues), 478.8 bits, see alignment E=1e-147 TIGR00449: tRNA-guanine family transglycosylase" amino acids 7 to 367 (361 residues), 461.3 bits, see alignment E=2e-142 PF01702: TGT" amino acids 15 to 368 (354 residues), 515.3 bits, see alignment E=4.4e-159

Best Hits

Swiss-Prot: 100% identical to TGT_AGRFC: Queuine tRNA-ribosyltransferase (tgt) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 100% identity to atu:Atu1677)

MetaCyc: 52% identical to preQ1 tRNA-ribosyltransferase (Clostridioides difficile)
tRNA-guanine transglycosylase. [EC: 2.4.2.29]

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UES8 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Atu1677 queuine tRNA-ribosyltransferase (Agrobacterium fabrum C58)
MHEKFTFTLKSTSGGARLGEVAMPRGVIRTPAFMPVGTVGTVKAMYLDQVRELGADIILG
NTYHLMLRPGPERVARLGGLHELIRWPHPILTDSGGFQVMSLSGLRKLDEKGVTFKSHVD
GSLHHMSPERSIEIQGMLDSDIQMQLDECIALPAERKEIERAMEMSLRWAERCRVAFGEQ
PGKAMFGIVQGGDQPDLRIRSAEGLKELDLKGYAVGGLAVGEPQDVMLGMLDITLPVLPT
EKPRYLMGVGTPDDILKSVARGIDMFDCVMPTRSGRHGLAFTRRGRVNIRNARHAEDMRP
LDEQSNCPASRDYSRAYLHHLTRSNEALGGMLLSWHNLAYYQELMQGIRTSIEEGRFADF
YAETIEMWARGDIDPV