Protein Info for Atu1670 in Agrobacterium fabrum C58

Annotation: alcohol dehydrogenase class III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 TIGR02818: S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase" amino acids 3 to 374 (372 residues), 584.6 bits, see alignment E=4.1e-180 PF08240: ADH_N" amino acids 27 to 116 (90 residues), 78.4 bits, see alignment E=7e-26 PF00107: ADH_zinc_N" amino acids 197 to 335 (139 residues), 78.1 bits, see alignment E=9.1e-26 PF13602: ADH_zinc_N_2" amino acids 261 to 368 (108 residues), 29.3 bits, see alignment E=2.2e-10

Best Hits

Swiss-Prot: 80% identical to ADHI_RHOS4: Alcohol dehydrogenase class-3 (adhI) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K00121, S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC: 1.1.1.1 1.1.1.284] (inferred from 99% identity to agr:AGROH133_06548)

MetaCyc: 78% identical to FlhA (Paracoccus denitrificans)
S-(hydroxymethyl)glutathione dehydrogenase. [EC: 1.1.1.284]

Predicted SEED Role

"S-(hydroxymethyl)glutathione dehydrogenase (EC 1.1.1.284)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 1.1.1.284)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.1.1.284

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIS7 at UniProt or InterPro

Protein Sequence (375 amino acids)

>Atu1670 alcohol dehydrogenase class III (Agrobacterium fabrum C58)
MDVRAAVAIQAGKPLEVMTVQLEGPRAGEVLIEVKATGICHTDDFTLSGADPEGLFPAIL
GHEGAGIVVDVGPGVTSVKKGDHVIPLYTPECRECYSCTSRKTNLCTSIRATQGQGVMPD
GTSRFSIGKDKIHHYMGCSTFSNFTVLPEIALAKINPDAPFDKVCYIGCGVTTGIGAVIN
TAKVEIGSTAIVFGLGGIGLNVLQGLRLAGADMIIGVDINNDRKAWGEKFGMTHFVNPKE
VGDDIVPYLVNMTKRNGDLIGGADYTFDCTGNTKVMRQALEASHRGWGKSVIIGVAGAGQ
EISTRPFQLVTGRNWMGTAFGGARGRTDVPKIVDWYMEGKIQIDPMITHTMPLEDINKGF
ELMHKGESIRGVVVY