Protein Info for Atu1648 in Agrobacterium fabrum C58

Annotation: mandelate racemase/muconate lactonizing enzyme family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02746: MR_MLE_N
  • amino acids 15 to 105 (91 residues), 43 bits, E=4.8e-15
• PF13378: MR_MLE_C
  • amino acids 135 to 292 (158 residues), 90.2 bits, E=1.7e-29

Best Hits

Swiss-Prot: 44% identical to AEEP_ECOLI: L-Ala-D/L-Glu epimerase (ycjG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to atu:Atu1648)

MetaCyc: 44% identical to L-Ala-D/L-Glu epimerase (Escherichia coli K-12 substr. MG1655)
RXN0-5228 [EC: 5.1.1.20]

Predicted SEED Role

"Muconate cycloisomerase (EC 5.5.1.1)" in subsystem Catechol branch of beta-ketoadipate pathway or Muconate lactonizing enzyme family (EC 5.5.1.1)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (8/9 steps found)
• superpathway of salicylate degradation (6/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (5/6 steps found)
• catechol degradation to β-ketoadipate (3/4 steps found)
• muropeptide degradation (1/4 steps found)
• mandelate degradation to acetyl-CoA (8/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation
• Toluene and xylene degradation

Isozymes

Compare fitness of predicted isozymes for: 5.5.1.1

Use Curated BLAST to search for 5.1.1.20 or 5.5.1.1

Sequence Analysis Tools

See A9CIT6 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Atu1648 mandelate racemase/muconate lactonizing enzyme family protein (Agrobacterium fabrum C58)
MPRYLQATTERFAVAGSFTISRGTRTHADVVTCTIRDGSFTGIGECVPYPRYGESIEGVT
ADIEAMADRVAAGLTRQELQQVMKPGAARNAVDCALWDLEAKMSGKRAAEQVLGQPAQPL
VTAYTISLADPDTMAAKTAENAGRPLLKIKTGTADDEARLRAVRAAAPEARIIIDANEGW
NDDNIEYYLKLAAELKISLIEQPLPAGKDAMLARIEHPVLICADESVHSTEDLAGLRDRY
DAINIKLDKTGGLTEALVMKAEAERLGFTIMVGCMLGTSLGMAPAVLVAQGTAFADLDGP
LLLAEDRDPGLVYEGSLVYPARPELWG