Protein Info for Atu1647 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 180 to 200 (21 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 257 to 283 (27 residues), see Phobius details amino acids 286 to 286 (1 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details PF13466: STAS_2" amino acids 30 to 94 (65 residues), 29.5 bits, see alignment E=1.1e-10 PF01740: STAS" amino acids 38 to 94 (57 residues), 29.4 bits, see alignment E=8.7e-11 TIGR00056: ABC transport permease subunit" amino acids 169 to 379 (211 residues), 220.6 bits, see alignment E=1.4e-69 PF02405: MlaE" amino acids 169 to 379 (211 residues), 231.3 bits, see alignment E=1.4e-72

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to atu:Atu1647)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYT6 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Atu1647 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MQEQDTRQQANPAAITEDDAVSGGGSRYVLSGSWRNSNLSGIFESLDRIEKSKPASPVDI
DLSAVEAIDTTGAWIIQRLRKDLEASGATVTLTGNDRIEDVIGQLPDKAEMDVEPVAREG
LVERIFAPIGQAVVQNGADFLAGMYILGSAVRGAQMKLGRGRGVSPAAIVNQIDHMGVRA
VPIIMLMSFLIGAIIAQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTAIMIAGRSGSA
ITAEIGSMKMREEIDALKVIGLNPVGVLVFPRLVALTIALPLLTILANFAALFGAAIVAL
AYSGITFEVFLSRLHGAVEESTIAAGMIKAPFMALIIGIVAAVEGMKVGGSAESLGKHVT
SSVVKSIFVVILVDGLFAIFYAAIDF