Protein Info for Atu1623 in Agrobacterium fabrum C58

Annotation: pyridine nucleotide-disulphide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details PF00890: FAD_binding_2" amino acids 44 to 88 (45 residues), 22 bits, see alignment 1.4e-08 PF07992: Pyr_redox_2" amino acids 44 to 325 (282 residues), 72.2 bits, see alignment E=7.7e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1623)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIU7 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Atu1623 pyridine nucleotide-disulphide oxidoreductase (Agrobacterium fabrum C58)
MQRRTLLKLAALSTIGVPYTKATASPSLSLLPSVHNKESITMNDVIIIGGSFAGLAAALQ
LGRARRKVIVLDTGLQRNRFAGRSHGMLGHDDKPPSAILAEARQQLARYPAIRIVNARAD
SISGTIDNFSVLTGDGETLSARRLILSYGVVDQMPDVSGFAENWGTSVIPCPYCDGFEVA
DQHWGLVWSGPQSMNQVRLFHDWTDRLTVFGNGHDITPDIRADLESRKVPVVDGRINEIA
RHGSHGATIKLDTSPDVEVDILFAHPRNKPSASLHDALGLATVNTPTGIALKTDERRETS
MPGIYAAGDLANPGIPSVTTATWQGAMAGIFAQQSMLV