Protein Info for Atu1614 in Agrobacterium fabrum C58

Annotation: phosphoglycolate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00702: Hydrolase" amino acids 10 to 186 (177 residues), 114.1 bits, see alignment E=2.2e-36 PF12710: HAD" amino acids 10 to 184 (175 residues), 54.1 bits, see alignment E=5.5e-18 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 11 to 221 (211 residues), 178.8 bits, see alignment E=2.2e-56 PF13419: HAD_2" amino acids 11 to 193 (183 residues), 136.9 bits, see alignment E=1.7e-43 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 69 to 193 (125 residues), 33.8 bits, see alignment E=7e-12 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 107 to 186 (80 residues), 29.6 bits, see alignment E=1.7e-10 PF13242: Hydrolase_like" amino acids 148 to 216 (69 residues), 37.2 bits, see alignment E=4.5e-13

Best Hits

Swiss-Prot: 100% identical to GPH_AGRFC: Phosphoglycolate phosphatase (gph) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to atu:Atu1614)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UEY9 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Atu1614 phosphoglycolate phosphatase (Agrobacterium fabrum C58)
MTSRPLSPLAIFDLDGTLVDTAADLVSSLNHTIAAAGLAPVTYDDLTHLVGQGARVMIKR
AFALRETELPEADIDPLYERFITHYRAEMPGESRPYPGIIETLDALSQAGITLAVCTNKT
EILAVPLLEKLGLTRYFAAITCGDTFAFRKPDARHILGTIEKAGGDVQRSIMVGDSINDI
LAARNAAVPSIGVTFGYTDVPMVELEPDVVIDDFAALTPALFEKLVSKGAAAA