Protein Info for Atu1604 in Agrobacterium fabrum C58

Annotation: poly-beta-hydroxybutyrate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 619 TIGR01838: poly(R)-hydroxyalkanoic acid synthase, class I" amino acids 84 to 618 (535 residues), 696 bits, see alignment E=1.4e-213 PF07167: PhaC_N" amino acids 133 to 304 (172 residues), 245.5 bits, see alignment E=2.6e-77 PF00561: Abhydrolase_1" amino acids 304 to 544 (241 residues), 57.7 bits, see alignment E=1.5e-19

Best Hits

Swiss-Prot: 62% identical to PHAC_RHIME: Poly(3-hydroxyalkanoate) polymerase subunit PhaC (phaC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 100% identity to atu:Atu1604)

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYW3 at UniProt or InterPro

Protein Sequence (619 amino acids)

>Atu1604 poly-beta-hydroxybutyrate synthase (Agrobacterium fabrum C58)
MAGVDGGAGKKGGKTPGFDASTAEAYLIRDPETFAINVARALENLGKAASEWLAPRERGE
IPQASADPVTDLVKTLSDVAEYWMAEPKRSLEAQTHLLSSYYDLWTKSLAQFSNDADSPP
ENVAESGPAQRRSKRFADADWQTNPFFDFLLKAYQTTVGFADRMVTEADGLDEHTRTKAL
FYMRQVTEALSPANFVFTNPQVFRETVASSGANLVKGMAQLAEDVAAGNGHLKLRQTDYS
KFVIGQNIAVTPGKVVAKSPLCEIIHYAPTTEKVFKPPLLIVPPWINKFYILDLNPQKSF
VGWCLEQGHSVFMVSWINPDAGLANKGWDDYINEGIDFALDTIEERTGEKQINAIGYCVG
GTLLSSALALHAQQGNERIRSATLLAAQTDFIHAGDLKVFIDEGQLAALDKHMQAVGYLD
GSIMATVFNMLRASDLIWPYVVDNYLRGAEPLPFDLLYWNSDSTRVTAASHSFYLRNCYL
ENNLARGLMRVAGKRINLGDITIPVYDLATRDDHIAPAKSVFTGAALFGGTVEFVLGASG
HIAGVINPPQLEKYQYWTGPSPSGDFEAWQAAATAHKGSWWMHWQNWIESQSTEKVKARK
PGDGKRPVLGDAPGTYVLS