Protein Info for Atu1602 in Agrobacterium fabrum C58

Annotation: transcriptional activator, Crp family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00027: cNMP_binding" amino acids 46 to 127 (82 residues), 37.8 bits, see alignment E=3.2e-13 PF13545: HTH_Crp_2" amino acids 162 to 236 (75 residues), 67 bits, see alignment E=2.4e-22 PF00325: Crp" amino acids 187 to 218 (32 residues), 52.4 bits, see alignment 6.6e-18

Best Hits

Swiss-Prot: 63% identical to FNRN_RHILV: Probable transcriptional activator (fnrN) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 100% identity to atu:Atu1602)

Predicted SEED Role

"putative FNR family transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIV6 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Atu1602 transcriptional activator, Crp family (Agrobacterium fabrum C58)
MDTLQKTIHNSEYPVVCRSCEARHGGLCSTLTPQQLCDLNRHSSRKKLEAGNELLGQGEL
VTSYGNILNGVVKLSKMMSDGRQQIVGLQFAPDFLGRPFMAESKMTAEAATDVEICLFPR
RIVDRMVTEVPDMERKLHSQSLKELDEARDWMLTLGRKSAQEKVASFLYMIATHIDPEND
DKSCFDLPLSRADIADFLGLTIETVSRQMTKLRKEGTIRIENNRHITVPDLDVLSEAAGN
D