Protein Info for Atu1595 in Agrobacterium fabrum C58

Annotation: NADPH:quinone reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF08240: ADH_N" amino acids 24 to 135 (112 residues), 86.2 bits, see alignment E=2.5e-28 PF00107: ADH_zinc_N" amino acids 177 to 304 (128 residues), 120 bits, see alignment E=9.8e-39 PF13602: ADH_zinc_N_2" amino acids 209 to 339 (131 residues), 84.2 bits, see alignment E=2.5e-27

Best Hits

KEGG orthology group: K00001, alcohol dehydrogenase [EC: 1.1.1.1] (inferred from 100% identity to atu:Atu1595)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIW1 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Atu1595 NADPH:quinone reductase (Agrobacterium fabrum C58)
MRALQLVDDRKLEKVDLPEPDAPGPGEVTLRVKAVALNHIDVWGWRGMAFAKRKMPLTIG
AEASGVVEAIGPGVSNVLPGQLVSVYGARTCGLCKPCREGRDNLCEHVQGVHGFHLDGFA
QEKINIPARQLVPAPHGIDAVAAALAPVTFGTVEHMLFDNAKLEPGETILIHAGGSGIGT
AAIQLAKKMGCTVITTVGSDDKIERAKALGADHVINYRTDRFEGVVRKLTKKKGVDVVFE
HVGKDTFVASMFSLKRGGRLVTCGSTSGVSTEINLMMLFQQQLKLLGSFGCRMENMANAM
QKMARGIVHPVIDTEVTFDDIDRALERMETRQVFGKIVLRMD