Protein Info for Atu1577 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (amino acid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF00497: SBP_bac_3" amino acids 7 to 223 (217 residues), 53.4 bits, see alignment E=1.1e-18

Best Hits

Swiss-Prot: 73% identical to AAPJ_RHIL3: General L-amino acid-binding periplasmic protein AapJ (aapJ) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K09969, general L-amino acid transport system substrate-binding protein (inferred from 100% identity to atu:Atu1577)

Predicted SEED Role

"Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIW8 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Atu1577 ABC transporter, substrate binding protein (amino acid) (Agrobacterium fabrum C58)
MKGKGFVTCGVSAGIPGFSNPDDKGEWSGIDVDYCRGIATAVFGDPSKAKFVALSSKDRF
PALQSGEVDVLTRNTTWTISRDTSLGFNFRTVNYYDGQGFIAKKGLNVKSALELSGAAVC
VQTGTTTELNLADYFKTNNLQYNPVVFEKESDATSAYDSGRCDVYTTDQSGLYAIRLKLK
NPDDNIVLPEVISKEPLGPAVRQGDDQWFDIVTWVHYAMVNAEELGITSKNVDEQKTSAN
PDVKRLLGTEEGTKIGTDLGVGNDWAYNIVKLVGNYGEVFDRNVGAGSPLKIERGQNALW
TKGGLQYAPPVR