Protein Info for Atu1493 in Agrobacterium fabrum C58

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 transmembrane" amino acids 32 to 59 (28 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 171 to 196 (26 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 375 to 401 (27 residues), see Phobius details amino acids 407 to 432 (26 residues), see Phobius details PF00654: Voltage_CLC" amino acids 87 to 424 (338 residues), 214.1 bits, see alignment E=1.6e-67

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 100% identity to atu:Atu1493)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ03 at UniProt or InterPro

Protein Sequence (593 amino acids)

>Atu1493 chloride channel protein (Agrobacterium fabrum C58)
MSTKPFRAPSMASFFDNLRASRLRAMFRRGELGLVALAVLIGVAAGLLVALIGALSTALH
ILVFGVERLSSSDLSGRIVLFGPIIGGMLLGLIIFILSKTRKKPMIDPIEANALHGGRLS
LTDSIIVCVQNIVSNGFGASVGLEAGYTQIASGVASKIGIKLKLRRGDMRILVGCGAAGA
IAAAFNAPLTGAFYAIELIIGTYTVVTLAPLIVSALVATTVIGLIGGHGLSIDIVDASRV
TPADYVPAIFLGVVCAAIGIVLMQAVSFIEETARKSAIPGWLRPTLGGVAVGGLALISPQ
VLSSGHGALHLNIDAELTIYGLAGLFMLKAAASAISIGSNFRGGLFFASLFMGSLLGKIF
ALCAPYIGYGSTAPIVYAVIGMSAFAAAIIGGPLTMTFLALELTGDFQITALVLAAVITT
SLVVRTTFGYSFATWRFHLRGESIRSAHDIGWIRDLTVGKMMRADIRKANVSMGLPAFKE
KFPLGSTQRVIMTHDDGRYAGMVLVPEIYADPMDRDPSKISLETYLHYKNDILLPTMNAR
QAAAAFDAAESEALVVVNDKIENRPVGLLTESHTLRRYSEELDLRRREASGEL