Protein Info for Atu1489 in Agrobacterium fabrum C58

Annotation: arsenical resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 TIGR02690: arsenical resistance protein ArsH" amino acids 2 to 215 (214 residues), 418.6 bits, see alignment E=1.8e-130 PF03358: FMN_red" amino acids 23 to 166 (144 residues), 111.6 bits, see alignment E=1.4e-36

Best Hits

Swiss-Prot: 83% identical to ARREH_RHIME: NADPH-dependent FMN reductase ArsH (arsH) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K11811, arsenical resistance protein ArsH (inferred from 100% identity to atu:Atu1489)

MetaCyc: 74% identical to ArsH (Pseudomonas putida KT2440)

Predicted SEED Role

"Arsenic resistance protein ArsH" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZ51 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Atu1489 arsenical resistance protein (Agrobacterium fabrum C58)
MQAQHLHGIDEQALRPAFSTHKPRILILYGSLREVSYSRLLAFEAGRLLERLGCEVRIFD
PKGLPLPDETPASHAKVQELRDLSQWSEGQVWVSPERHGAMTGIMKSQIDWIPLAVGSVR
PTQGKTLAVMEVSGGSQSFNAVNQMRILGRWMRMITIPNQSSVARAFQEFDEDGRMRPSS
YYDRVVDVCEELVKFTLLTRDASAYLTDRYSERKEQAAELEKRVSLKSI