Protein Info for Atu1476 in Agrobacterium fabrum C58

Annotation: esterase D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 TIGR02821: S-formylglutathione hydrolase" amino acids 3 to 276 (274 residues), 432.3 bits, see alignment E=4.4e-134 PF00756: Esterase" amino acids 21 to 269 (249 residues), 187.7 bits, see alignment E=3.4e-59

Best Hits

Swiss-Prot: 48% identical to SFGH1_ECOHS: S-formylglutathione hydrolase FrmB (frmB) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K01070, S-formylglutathione hydrolase [EC: 3.1.2.12] (inferred from 100% identity to atu:Atu1476)

MetaCyc: 46% identical to S-formylglutathione hydrolase FrmB (Escherichia coli K-12 substr. MG1655)
S-formylglutathione hydrolase. [EC: 3.1.2.12]

Predicted SEED Role

"S-formylglutathione hydrolase (EC 3.1.2.12)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 3.1.2.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ11 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Atu1476 esterase D (Agrobacterium fabrum C58)
MNIISQNTAFGGMQGVFSHQSETLKSEMTFAVYVPPKAIHEPCPVVWYLSGLTCTHANVM
EKGEYRRMASELGLVVVCPDTSPRGNDVPDELTNWQMGKGAGFYLDATEEPWSEHYQMYS
YVTEELPALIGQHFRADMSRQSIFGHSMGGHGAMTIALKNPERFKSCSAFAPIVAPSSAD
WSEPALEKYLGADRAAWRRYDACSLVEDGARFPEFLIDQGKADSFLEKGLRPWLFEEAIK
GTDIGLTLRMHDRYDHSYYFISTFMDDHLKWHAERLG