Protein Info for Atu1470 in Agrobacterium fabrum C58

Annotation: Camphor resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details TIGR00494: protein CrcB" amino acids 6 to 120 (115 residues), 100.1 bits, see alignment E=5.2e-33 PF02537: CRCB" amino acids 6 to 118 (113 residues), 101.7 bits, see alignment E=1.3e-33

Best Hits

Swiss-Prot: 100% identical to CRCB_AGRFC: Putative fluoride ion transporter CrcB (crcB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K06199, CrcB protein (inferred from 100% identity to atu:Atu1470)

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UFC8 at UniProt or InterPro

Protein Sequence (125 amino acids)

>Atu1470 Camphor resistance protein (Agrobacterium fabrum C58)
MINIALVATGGAIGSVFRYLVGVWSMRLAGPNFPWGTLAVNIVGSFLIGLLVELVARRLN
ASIEMRLFLVTGVLGGFTTFSSFSLDAVSLFERGALGLSAFYILASLVVSIAAVFAGLAL
GRNLF