Protein Info for Atu1468 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07987: DUF1775" amino acids 24 to 171 (148 residues), 132 bits, see alignment E=2.2e-42 PF04314: PCuAC" amino acids 199 to 308 (110 residues), 142 bits, see alignment E=6.3e-46

Best Hits

KEGG orthology group: K09796, hypothetical protein (inferred from 100% identity to atu:Atu1468)

Predicted SEED Role

"Copper metallochaperone, bacterial analog of Cox17 protein / Conserved membrane protein in copper uptake, YcnI" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ17 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Atu1468 hypothetical protein (Agrobacterium fabrum C58)
MKTTKIITCTLFVASVSTAPAFAHATFVDGSAEQDSTIVAALQVPHGCDGGLATTEVQIK
LPEGFISAKPQPKAGWELEIIKGEYQKTYKNHGKDIASGAVEVRWKGGDLPDEFYDTFAV
QGKISGVEVGQDLPFKVTQLCGDKGKVSWDEVAAAGVDPHSLKSPAPTIKVAAKAHPGGH
DHSGMSMDMDVVKVGNLEVSDGATKAMLPGQPVGGGYVTIKNTGDSDDKLVGIESSAAGR
AEIHEMAMVNDVMKMRKLDEGIVIPAGQTVELKPGGLHMMFFNVKKPFAEGDKVPVTLVF
EKAGKVEIVLSAGAAKGGTDHQHN