Protein Info for Atu1464 in Agrobacterium fabrum C58

Annotation: glycine cleavage system T protein, aminomethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF01571: GCV_T" amino acids 1 to 240 (240 residues), 261.3 bits, see alignment E=8.4e-82 TIGR00528: glycine cleavage system T protein" amino acids 1 to 352 (352 residues), 301.9 bits, see alignment E=2.9e-94 PF08669: GCV_T_C" amino acids 271 to 352 (82 residues), 71.5 bits, see alignment E=4.3e-24

Best Hits

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 100% identity to atu:Atu1464)

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZ70 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Atu1464 glycine cleavage system T protein, aminomethyltransferase (Agrobacterium fabrum C58)
MVPFAGYDMPVQYPAGVLKEHLQTRTSAGLFDVSHMGQVILKARSGNNEDAARALEKLVP
VDIFGLKEGRQRYGFFTDDNGNILDDLMITNRGDHLFVVVNASCKDADVAHMKAHLSDTC
EITLLVDRALIALQGPRAEAVLAELWAGVSEMKFMDVQGVPLHDVPCIVSRSGYSGEDGF
EISVPADKAEEIAKALLEHPDCEPIGLGARDSLRLEAGLCLYGNDIDTTTSPIEASLEWA
IQKARRAGGEREGGFPGAERILRELKDGTSRRRVGLKPEGKAPVRGHSKLFADAEGVTEI
GEVTSGGFGPSVEGPVAMGYVPVSYAAPGTAIFAEVRGKYLPVTVAALPFIKPTYKR