Protein Info for Atu1463 in Agrobacterium fabrum C58

Annotation: glycine cleavage system component H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 2 to 119 (118 residues), 150 bits, E=1.9e-48
• PF01597: GCV_H
  • amino acids 2 to 119 (118 residues), 147.1 bits, E=1.2e-47

Best Hits

Swiss-Prot: 100% identical to GCSH_AGRFC: Glycine cleavage system H protein (gcvH) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 100% identity to atu:Atu1463)

MetaCyc: 56% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Sequence Analysis Tools

See Q8UFD5 at UniProt or InterPro

Protein Sequence (120 amino acids)

>Atu1463 glycine cleavage system component H (Agrobacterium fabrum C58)
MLKFTAEHEWLKFEGDIATVGITSHAAEQLGDLVFVELPEVGATFAKDGDAATVESVKAA
SDVYCPLDGEVVEINQAIVDDPSLVNSDPQGAGWFFKLKLSNAADAETLLDEAAYKELIA