Protein Info for Atu1451 in Agrobacterium fabrum C58

Annotation: GTP-binding protein HFLX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 TIGR03156: GTP-binding protein HflX" amino acids 31 to 374 (344 residues), 447.4 bits, see alignment E=1.6e-138 PF13167: GTP-bdg_N" amino acids 32 to 118 (87 residues), 98 bits, see alignment E=7.9e-32 PF16360: GTP-bdg_M" amino acids 121 to 200 (80 residues), 99.7 bits, see alignment E=2.2e-32 PF01926: MMR_HSR1" amino acids 208 to 330 (123 residues), 71.4 bits, see alignment E=1.3e-23 PF19275: HflX_C" amino acids 341 to 442 (102 residues), 145 bits, see alignment E=1.4e-46

Best Hits

KEGG orthology group: K03665, GTP-binding protein HflX (inferred from 100% identity to atu:Atu1451)

Predicted SEED Role

"GTP-binding protein HflX" in subsystem Hfl operon or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U5B2 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Atu1451 GTP-binding protein HFLX (Agrobacterium fabrum C58)
MRAVVLVPFLKQQRENRDAASAPAAPGRSVEAKLEEAKGLALAIDLEVTQGLVVPVNQPR
PATLFGTGKIEEIGHLLDETNSGLVIVDHPLTPVQQRNLEKQWNAKVIDRTGLILEIFGR
RASTKEGTLQVDLAHLNYQKGRLVRSWTHLERQRGGAGFMGGPGETQIEADRRLLQDRIV
KLEKELEQVVRTRQLHRAKRRKVPHPIVALVGYTNAGKSTLFNRITGAGVLAEDMLFATL
DPTLRRMKLPHGRTVILSDTVGFISDLPTHLVAAFRATLEEVLEADLVLHVRDMSDPDNA
AQSADVLRILGDLGIDEKEAEKRIIEVWNKVDRLEPEAHDAIMQRAEGRSDIRAVSAITG
EGVDALMEEISKRLSGVLTETTVVLSVEQLPLISWVYSNSIVDNREDHEDGSVALDVRLS
EAQAVELERKLGKTAGREREDWER