Protein Info for Atu1448 in Agrobacterium fabrum C58

Annotation: two component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 93.8 bits, see alignment E=2.6e-30 PF00158: Sigma54_activat" amino acids 143 to 305 (163 residues), 168.1 bits, see alignment E=5.1e-53 PF14532: Sigma54_activ_2" amino acids 143 to 310 (168 residues), 73.4 bits, see alignment E=8.3e-24 PF07728: AAA_5" amino acids 166 to 274 (109 residues), 22.9 bits, see alignment E=2.6e-08 PF25601: AAA_lid_14" amino acids 312 to 390 (79 residues), 78.7 bits, see alignment E=8.6e-26 PF02954: HTH_8" amino acids 412 to 450 (39 residues), 44.9 bits, see alignment 2.7e-15

Best Hits

Swiss-Prot: 67% identical to NTRX_AZOC5: Nitrogen assimilation regulatory protein NtrX (ntrX) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K13599, two-component system, NtrC family, nitrogen regulation response regulator NtrX (inferred from 99% identity to agr:AGROH133_05957)

Predicted SEED Role

"Nitrogen regulation protein NtrX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ23 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Atu1448 two component response regulator (Agrobacterium fabrum C58)
MASDILVVDDEADIREIVAGILSDEGHETRMAFDSDSALAAISERVPRLIFLDIWMQGSK
LDGLALLDEIKSRHPEIPVVMISGHGNIETAVNAIKRGAFDFIEKPFKADRLILIAERAL
ENSKLKREVQELKKRTGDAVELVGASLAVSQLRQTIDRVAPTNSRIMILGPSGSGKELVA
RMVHKKSSRATGPFVALNAATITPDRMEIALFGTEGLPGQPRKVGALEEAHRGVLYLDEV
GEMPRETQNKILRVLVDQQFERVGGGKRVKVDVRIISSTAHHLESLIAEGQFREDLYHRL
AVVPVKVPALSERREDIPFLVDMFMRQISEQAGIRPRKIGDDAMAVLQTHDWPGNIRQLR
NNIERLMILARPEGGEAPISADMLPSDIGDMLPKISAQGDQHIMTLPLREAREMFERDYL
MAQINRFGGNISRTAEFVGMERSALHRKLKSLGV