Protein Info for Atu1445 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF00989: PAS" amino acids 17 to 119 (103 residues), 35.6 bits, see alignment E=1.2e-12 PF00512: HisKA" amino acids 143 to 198 (56 residues), 51.2 bits, see alignment 1.6e-17 PF02518: HATPase_c" amino acids 245 to 363 (119 residues), 68.7 bits, see alignment E=9.1e-23

Best Hits

Swiss-Prot: 84% identical to NTRB_RHIME: Sensory histidine kinase/phosphatase NtrB (ntrB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07708, two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC: 2.7.13.3] (inferred from 100% identity to atu:Atu1445)

Predicted SEED Role

"Nitrogen regulation protein NtrB (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ24 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Atu1445 two component sensor kinase (Agrobacterium fabrum C58)
MSADKHSPADANQLAMAVLNAVQNPVILVDGEGFISFANWEAEAFFGASASHLARYRVST
FIPFGSPLLALIDQVRERRAPVNEYRVDLSSPRLGQDKLVDLYVAPVVSEPGSVVVVFQE
RSMADKIDRQLTHRAAARSVTGLASMLAHEIKNPLSGIRGAAQLLEMSVPDEDRALTRLI
CDETDRIVSLVDRMEIFSDERPVDRVPVNIHSVLDHVKAIAKAGFARNIKISENYDPSLP
AVYANRDQLVQVFLNLVKNAAEAVANQPDGEVVLTTAYRPGIRLSVAGSRERISLPLEFC
VHDNGPGVPSDLLPHLFDPFITTKTNGSGLGLALVAKLIGAHGGIVECDSQNHRTTFRVL
MPVSPEVALDDSSLPNTTGNDR