Protein Info for Atu1437 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 141 (135 residues), 31.9 bits, see alignment E=7.7e-12 amino acids 158 to 299 (142 residues), 28.3 bits, see alignment E=9.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1437)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ29 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Atu1437 hypothetical protein (Agrobacterium fabrum C58)
MNNRTGLGVFYGMLAGALWGGIFLAPKLVPDFSALQLSTARYLTYGLISLIIIGPRLKRV
SAHFGAREWIALGWLSMIGNIAYYVFISTAVKLSGVAFTSIIIGFLPVAVTIIGSRDHGA
VSLKRLWPSLAFGAIGIVGISWQSLTENDAGLDVSRLIGLASALGALASWTAFAVGNARW
LSRLHDVSADDWNMMTGVVTGGLALLLAIPAFGFGGESHSSGDWLHFAAIAAGLGFTASI
LGNAFWNRMSRMLPLTMVGQMILFETLFALLYGFLWEGHGPTFVEIVAICSVVLSVVLCM
RAHRPEKVVV