Protein Info for Atu1429 in Agrobacterium fabrum C58

Annotation: pyruvate dehydrogenase alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details TIGR03182: pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit" amino acids 1 to 305 (305 residues), 506.8 bits, see alignment E=9e-157 PF00676: E1_dh" amino acids 1 to 297 (297 residues), 364.5 bits, see alignment E=5.3e-113 PF13292: DXP_synthase_N" amino acids 90 to 165 (76 residues), 28.8 bits, see alignment E=1.1e-10

Best Hits

Swiss-Prot: 92% identical to ODPA_RHIME: Pyruvate dehydrogenase E1 component subunit alpha (pdhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 100% identity to atu:Atu1429)

MetaCyc: 48% identical to pyruvate dehydrogenase complex E1 component alpha subunit (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component alpha subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZ99 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Atu1429 pyruvate dehydrogenase alpha subunit (Agrobacterium fabrum C58)
MLLIRRFEEKAGQLYGMGFIGGFCHLYIGQEAVVVGMQMSQKEGDQVITAYRDHGHMLAL
GMSARGVMAELTGRKGGLSKGKGGSMHMFSKEKHFYGGHGIVGAQVSLGTGLAFANRYRG
NDNVSVTYFGDGAANQGQVYESFNMAALWKLPIIYIVENNRYAMGTSTARATAQSNYSLR
GQSFGIPGVQVDGMDVRAVKAAADQALEHCRSGKGPIILEMLTYRYRGHSMSDPAKYRSK
DEVQKMRSEHDPIEQVKARLLDHGWASEDELKAIDKDVRDIVADSADFAQNDPEPDVSEL
YTDILL