Protein Info for Atu1407 in Agrobacterium fabrum C58

Annotation: gluconate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF08659: KR" amino acids 13 to 189 (177 residues), 44.7 bits, see alignment E=2.2e-15 PF00106: adh_short" amino acids 13 to 203 (191 residues), 184.9 bits, see alignment E=1.8e-58 PF13561: adh_short_C2" amino acids 20 to 252 (233 residues), 198.2 bits, see alignment E=2.5e-62

Best Hits

Swiss-Prot: 46% identical to GNO_GLUOX: Gluconate 5-dehydrogenase (gno) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 100% identity to atu:Atu1407)

MetaCyc: 46% identical to D-gluconate 5-dehydrogenase monomer (Gluconobacter oxydans 621H)
1.1.1.-

Predicted SEED Role

"5-keto-D-gluconate 5-reductase (EC 1.1.1.69)" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.1.69)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.69

Use Curated BLAST to search for 1.1.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ43 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Atu1407 gluconate dehydrogenase (Agrobacterium fabrum C58)
MSNQIIFDLGGRTALVTGSSRGLGRAMAEGLAVAGARILINGTDPSRVAQTVQEFRNVGH
DAEAVAFDVTSESEIIEAFARLDEQGIDVDILVNNAGIQFRKPMIELETADWQRVIDTNL
TSAFMIGREAAKRMIPRGYGKIVNIGSLTSELARATVAPYTVAKGGIKMLTRAMAAEWAQ
YGIQANAIGPGYMLTDMNQALIDNPEFDAWVKARTPAKRWGKPQELVGTAVFLSASASDY
VNGQIIYVDGGMLSVL