Protein Info for Atu1403 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 76 to 102 (27 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 291 (199 residues), 59.5 bits, see alignment E=1.9e-20

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu1403)

Predicted SEED Role

"Glucosamine ABC transport system, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ46 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Atu1403 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MKRAQLAGARLDGHPLTPYLFAAPVGIYLLLFQFYPLVQQFFMSFTATDLLTPNVNPFVG
IENYSFLIEDGELWKVLWITAIYTVACVIFAIGTGLGSAMLLDSPFFGRGIARALITVPW
AAPSVAVALVFTWIFNSQYGIFNRVLTGLGLPFGGENWLDDPNLALPAILLTTVWQIFPF
SSVVILAALQGVPHELKEAAVIDGADRLNIFKTATWPTIQPTVLMLTLFVTIWSLRRFDL
IWLMTQGGPIGATNTLVIELYRQGFVYRDLGSAASIGMIGLSIALLVTVIYFKVTRMTEQ
AQGKR