Protein Info for Atu1382 in Agrobacterium fabrum C58

Annotation: UDP glucosamine N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD" amino acids 17 to 347 (331 residues), 431.3 bits, see alignment E=9.9e-134 PF04613: LpxD" amino acids 34 to 101 (68 residues), 47.8 bits, see alignment E=1.5e-16 PF00132: Hexapep" amino acids 147 to 180 (34 residues), 35.1 bits, see alignment 1.1e-12 amino acids 241 to 276 (36 residues), 31.6 bits, see alignment 1.5e-11

Best Hits

Swiss-Prot: 100% identical to LPXD_AGRFC: UDP-3-O-acylglucosamine N-acyltransferase (lpxD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to atu:Atu1382)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UFL5 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Atu1382 UDP glucosamine N-acyltransferase (Agrobacterium fabrum C58)
MEYNAFFPPHEGLRLKDIADLFGAELSDDAAGERIIRSVAPVYRAKPDQLCYILSRKSGE
ELLTCEAGAVICDAALKSLIPSHIPALISKTPHTLFAQVGALLHPSAMRPSLVARMEAEI
SPAAYVDPSAKLEPGVIVEPMAVIGAGVHIGAGTRIGPGVVIGSDVQIGRDCTIAGGASI
LAALLGNNVIIHNGARIGQDGFGYAPGPRGMLKIVQIGRVIIQDHVEVGANTTIDRGTMD
DTVIGEGTKIDNQVQIGHNVRIGRHCGIVSGVGIAGSTRIGDGVMIGGATGVNGHITIGD
GVQIAAMSGVVSDVPAGTRYGGIPARPMKHFLRDMADILARAEERDKKTGEKNNG