Protein Info for Atu1377 in Agrobacterium fabrum C58

Annotation: ribosome recycling factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR00496: ribosome recycling factor" amino acids 10 to 185 (176 residues), 211.5 bits, see alignment E=3.5e-67 PF01765: RRF" amino acids 20 to 183 (164 residues), 219 bits, see alignment E=1.7e-69

Best Hits

Swiss-Prot: 100% identical to RRF_AGRFC: Ribosome-recycling factor (frr) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02838, ribosome recycling factor (inferred from 100% identity to atu:Atu1377)

Predicted SEED Role

"Ribosome recycling factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UFM0 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Atu1377 ribosome recycling factor (Agrobacterium fabrum C58)
MSGIDLNDIKRRMDGAINAFKSDIASLRTGRASANILDPVTIDAYGSRVPLNQVANITVP
EPRMLGVNIWDKSMVNAVDRAIRESNLGLNPIVDGQNLRIPLPELNEERRKSLVKVAHEY
SEKAKVAIRHVRRDGMDGLKKAEKDGDIGQDESRGQSEKVQKMTDDTISEIDRLLAEKEK
EIMQV