Protein Info for Atu1352 in Agrobacterium fabrum C58

Annotation: dihydropteroate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00809: Pterin_bind
  • amino acids 1 to 236 (236 residues), 255.2 bits, E=3.7e-80
• TIGR01496: dihydropteroate synthase
  • amino acids 1 to 250 (250 residues), 300.7 bits, E=5.1e-94

Best Hits

Swiss-Prot: 46% identical to DHPS_BACSU: Dihydropteroate synthase (sul) from Bacillus subtilis (strain 168)

KEGG orthology group: K00796, dihydropteroate synthase [EC: 2.5.1.15] (inferred from 100% identity to atu:Atu1352)

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• tetrahydrofolate biosynthesis II (2/3 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.15

Sequence Analysis Tools

See A9CJ69 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Atu1352 dihydropteroate synthase (Agrobacterium fabrum C58)
MAIVNATPDSFSDGGRYLAVDAAFSHALTCVEEGADIIDIGGESTRPGAAAVTEAEEQDR
VLPVIEKLRCETDVLISVDTYRAATARLAIGAGAHIVNDVFGLQKDPDMAGVVASTRAGI
CIMHTGRDRQKLADVIDDQFEFLNRSLEIAEAAGIALDAVVLDPGFGFAKDESENVALMA
RFGELAAFGLPVLAGTSRKRFIGSLTGRDVAEERDIGTAATTAILRLAGASIFRVHNVAA
TRDALAIADAVLAKASAKADA