Protein Info for Atu1318 in Agrobacterium fabrum C58

Annotation: glutamyl-tRNA-Gln-amidotransferase chain C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 TIGR00135: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit" amino acids 3 to 95 (93 residues), 105.3 bits, see alignment E=8e-35 PF02686: GatC" amino acids 19 to 90 (72 residues), 76.1 bits, see alignment E=1e-25

Best Hits

Swiss-Prot: 100% identical to GATC_AGRFC: Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (gatC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02435, aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C [EC: 6.3.5.6 6.3.5.7] (inferred from 100% identity to atu:Atu1318)

MetaCyc: 39% identical to glutamyl-tRNAGln amidotransferase subunit C (Bacillus subtilis)
Glutaminyl-tRNA synthase (glutamine-hydrolyzing). [EC: 6.3.5.7]

Predicted SEED Role

"Aspartyl-tRNA(Asn) amidotransferase subunit C (EC 6.3.5.6) @ Glutamyl-tRNA(Gln) amidotransferase subunit C (EC 6.3.5.7)" (EC 6.3.5.6, EC 6.3.5.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.6, 6.3.5.7

Use Curated BLAST to search for 6.3.5.6 or 6.3.5.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UFS9 at UniProt or InterPro

Protein Sequence (95 amino acids)

>Atu1318 glutamyl-tRNA-Gln-amidotransferase chain C (Agrobacterium fabrum C58)
MSVDLATVKRVARLARIAVSEEEAQNMLGQLNGILGFVEQLSEVNVDGVEPMTSVTPVEM
KKRADVVTDGNKADDIVANAPATDRDFFMVPKVVE