Protein Info for Atu1303 in Agrobacterium fabrum C58

Annotation: exoribonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 784 TIGR02063: ribonuclease R" amino acids 37 to 748 (712 residues), 698.5 bits, see alignment E=1e-213 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 151 to 735 (585 residues), 460.6 bits, see alignment E=8.2e-142 PF17876: CSD2" amino acids 206 to 270 (65 residues), 29.8 bits, see alignment E=7.8e-11 PF00773: RNB" amino acids 288 to 614 (327 residues), 310.4 bits, see alignment E=2.3e-96 PF00575: S1" amino acids 665 to 733 (69 residues), 32.3 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 100% identity to atu:Atu1303)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJ94 at UniProt or InterPro

Protein Sequence (784 amino acids)

>Atu1303 exoribonuclease (Agrobacterium fabrum C58)
MSKAPRQRQGSASDGFGRTGRGKRVSEGEGIIHGEVPSREVLLKFIADHPQQASKREIAK
AFGLKGENRIVLKALLKELEVDGMVHKSRKSLTRPGGLPPVTVLDITTRDKDGELIGRPA
EWPEDMGAAPAVLIRQSSQDRGKKAPAAGLGDRILAKIFPSKDTVGPAYTARVVKLIDRR
QNALLGVFKQTEGGGGRLMPIDRRGEEMVIDPDGVGDAKDGDLIEVETSRNSGRYGLTRA
KVLSVVGSVASEKAISMIAIYAHGIPHIFPPNVLAEADAAKAATMSHREDWRDLPLITID
PADAKDHDDAVYAELDPSPDNPDGVIVTVAIADVSWYVRPGAPLDREALKRGNSVYFPDR
VVPMLPERISNDLCSLKEGVDRPALAVRMTFSKEGRKASHTFHRIMMKSAAKLSYQQAQA
AIDGNPDDKTGTLLEPILKPLWHAYEVMKRGRDRRQPLELDMPERKIQLRPDGTVDKVVI
PERLDAHKLIEEMMIQANVAAAETLETKKQRLVYRVHDAPTLSKQEVLREFLGTIGISMA
KGVAMRANSFNGILARALDTPHQIMVNEMVLRSQSQAIYSPENIGHFGLNLMKYAHFTSP
IRRYADLIVHRALVGSLGLGEGGITPQEEATLDDIAAEISTFERRAMAAERDTVNRLIAH
HLSERVGEEFEGRVGGVTKAGLFVALPQFGADGFVPISTLGTDYFFYDEAHQALTGEKTG
LGYQLGDTVQVRLAEAVPLAGALRFEMLSPGRKMPVGSRSFHKAGRRTSRPGAKPGTRPP
RGRR