Protein Info for Atu1284 in Agrobacterium fabrum C58

Annotation: birA bifunctional protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase
  • amino acids 20 to 253 (234 residues), 150 bits, E=4e-48
• PF03099: BPL_LplA_LipB
  • amino acids 45 to 148 (104 residues), 54.9 bits, E=8.8e-19
• PF02237: BPL_C
  • amino acids 210 to 256 (47 residues), 58.3 bits, 5.6e-20

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 100% identity to atu:Atu1284)

Predicted SEED Role

"Biotin-protein ligase (EC 6.3.4.15)" in subsystem Biotin biosynthesis (EC 6.3.4.15)

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

See A9CJA1 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Atu1284 birA bifunctional protein (Agrobacterium fabrum C58)
MSSTHKHTGRMSIDDFRHEAMAETPSTNLECFARARAGDGGNLWVTAIRQTGGRGRRGRP
WVSEPGNLYASLLLIDPAPVERIGSLPLAFALAVYRAIRAVLPTAGEPLEIKWPNDVLIG
RRKTCGILMEAELLPDGRRAIVIGIGINIAHKPDNPLYPVTMLSEHGASCSPDELFAHLF
RETAEVLRNWDEGRGVSGIMTGWRAAACGIGEHITVNFPDRSIGGRFVGIDDNGYLLLDE
DEGARRSIAAGDVFFG