Protein Info for Atu1284 in Agrobacterium fabrum C58

Annotation: birA bifunctional protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 20 to 253 (234 residues), 150 bits, see alignment E=4e-48 PF03099: BPL_LplA_LipB" amino acids 45 to 148 (104 residues), 54.9 bits, see alignment E=8.8e-19 PF02237: BPL_C" amino acids 210 to 256 (47 residues), 58.3 bits, see alignment 5.6e-20

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 100% identity to atu:Atu1284)

Predicted SEED Role

"Biotin-protein ligase (EC 6.3.4.15)" in subsystem Biotin biosynthesis (EC 6.3.4.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJA1 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Atu1284 birA bifunctional protein (Agrobacterium fabrum C58)
MSSTHKHTGRMSIDDFRHEAMAETPSTNLECFARARAGDGGNLWVTAIRQTGGRGRRGRP
WVSEPGNLYASLLLIDPAPVERIGSLPLAFALAVYRAIRAVLPTAGEPLEIKWPNDVLIG
RRKTCGILMEAELLPDGRRAIVIGIGINIAHKPDNPLYPVTMLSEHGASCSPDELFAHLF
RETAEVLRNWDEGRGVSGIMTGWRAAACGIGEHITVNFPDRSIGGRFVGIDDNGYLLLDE
DEGARRSIAAGDVFFG