Protein Info for Atu1251 in Agrobacterium fabrum C58

Annotation: O-acetylhomoserine sulfhydrylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01326: O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
  • amino acids 8 to 424 (417 residues), 617.7 bits, E=4.5e-190
• PF01053: Cys_Met_Meta_PP
  • amino acids 9 to 424 (416 residues), 437.1 bits, E=1.1e-134
• PF01212: Beta_elim_lyase
  • amino acids 62 to 209 (148 residues), 30.3 bits, E=6.9e-11
• PF01041: DegT_DnrJ_EryC1
  • amino acids 62 to 188 (127 residues), 29.7 bits, E=1e-10
• PF00155: Aminotran_1_2
  • amino acids 64 to 222 (159 residues), 26.9 bits, E=7e-10
• PF00266: Aminotran_5
  • amino acids 136 to 215 (80 residues), 23.2 bits, E=8e-09

Best Hits

Swiss-Prot: 53% identical to METY_LEPME: O-acetyl-L-homoserine sulfhydrylase (metY) from Leptospira meyeri

KEGG orthology group: K01740, O-acetylhomoserine (thiol)-lyase [EC: 2.5.1.49] (inferred from 100% identity to atu:Atu1251)

MetaCyc: 53% identical to O-acetylhomoserine sulfhydrylase (Leptospira meyeri)
O-acetylhomoserine aminocarboxypropyltransferase. [EC: 2.5.1.49]

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• L-methionine biosynthesis I (4/5 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)
• homocysteine and cysteine interconversion (1/4 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (1/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (1/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Cysteine metabolism
• Methionine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48, 2.5.1.49

Use Curated BLAST to search for 2.5.1.48 or 2.5.1.49

Sequence Analysis Tools

See A9CJB9 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Atu1251 O-acetylhomoserine sulfhydrylase (Agrobacterium fabrum C58)
MSSNNPGFSTLAVHAGAQPDPTTGARATPIYQTTAYAFRDADHAAALFGLKEFGNIYTRI
MNPTQAVLEERVAALEGGTAALAVASGHAAQLLVFHTLMQSGDNFVAARQLYGGSINQFG
HAFKGFDWQVRWADAADPASFEAQINERTRAIFIESLANPGGTFVDIAAIADVAHRHGLP
LIVDNTMASPYLLRPLEHGADIVLHSLTKFLGGHGNSMGGIIVDGGTFDWSATDRFPALS
QPRPEYSGVLLHQTFGNFAFAIACRVLGLRDLGPAISPFNAFLILTGIETLPLRVQRHSD
NALAVAKWLKAHPKVGWVHYAGLEDSDNHAIQQHYSPKGAGSVFTFGVKGGYAAGKALVE
GLQLFSHLANIGDTRSLVIHPASTTHAQLTPEQQTAAGAGPDVVRLSIGIEDVKDIIADL
EQSFAKV