Protein Info for Atu1245 in Agrobacterium fabrum C58

Annotation: agmatinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00491: Arginase" amino acids 44 to 306 (263 residues), 277.5 bits, see alignment E=7e-87 TIGR01230: agmatinase" amino acids 44 to 307 (264 residues), 222.1 bits, see alignment E=5.6e-70

Best Hits

Swiss-Prot: 49% identical to SPEB_NEIMB: Agmatinase (speB) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 100% identity to atu:Atu1245)

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJC2 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Atu1245 agmatinase (Agrobacterium fabrum C58)
MPAKTIDHAFTATTLTSAATDPTHAGVLSFMRRKYTKNLKGVSTAIWGIPFDAATSNRPG
ARFGPQAIRRASAIFDNDPQYPFARDLFAHMPTIDYGDCLLDYGNHWKTPDTIEKEARRI
ISKTDYLLTLGGDHFITWPLLKAHVAKHGRLALVQFDAHQDTWFDDGKRIDHGSFVARAV
RDGLIDPDRSIQIGIRTHAPDDFGIRILHGYEVEDMRASDIASLIVKHTGGMPAYLTFDI
DCLDPAFAPGTGTPVAGGPTSAKILSVLRGLGQLDIRGSDVVEVAPAYDHADITAIAGAT
VAMYMLGLRAERLAKAG