Protein Info for Atu1242 in Agrobacterium fabrum C58

Annotation: cytochrome oxidase assembly factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details PF02628: COX15-CtaA" amino acids 32 to 351 (320 residues), 383.1 bits, see alignment E=4.9e-119

Best Hits

Swiss-Prot: 100% identical to CTAA_AGRFC: Heme A synthase (ctaA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 100% identity to atu:Atu1242)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZN9 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Atu1242 cytochrome oxidase assembly factor (Agrobacterium fabrum C58)
MRSNGMTMANGSVDMVVEAALQKQEKDRRLLRIWLRVVLFTLFCLVLVGGATRLTESGLS
ITEWKPIHGAIPPLSVAEWEEEFQLYKRIPQYQEINKGMSLDEFKTIFWWEWAHRLLART
IGLVFALPLAFFWLTGRVEKRLRLPLVGLLALGGFQGFVGWWMVSSGLVNRTDVSQYRLA
THLTIACLIFAGCMWILRGLSHHSPDAADERTGRGFAALLTVLCLFQIYLGALVAGLNAG
LSYNTWPLMDGSLVPGDLFLQQPWWINLFENPKTVQFVHRLGAYTLFAATLWHMVSMARA
LPGTPHARRAVLFFVLISVQAGLGITTLLMHVDIHVALAHQGMALILLGFSVAHWRGFIG
EYPAPVAVEVRD