Protein Info for Atu1237 in Agrobacterium fabrum C58

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF13439: Glyco_transf_4" amino acids 31 to 204 (174 residues), 84.8 bits, see alignment E=2.2e-27 PF13579: Glyco_trans_4_4" amino acids 32 to 202 (171 residues), 69.9 bits, see alignment E=1e-22 PF13477: Glyco_trans_4_2" amino acids 40 to 148 (109 residues), 25.8 bits, see alignment E=3.1e-09 PF20706: GT4-conflict" amino acids 194 to 375 (182 residues), 29.1 bits, see alignment E=1.5e-10 PF00534: Glycos_transf_1" amino acids 205 to 350 (146 residues), 86.9 bits, see alignment E=3.7e-28 PF13692: Glyco_trans_1_4" amino acids 219 to 352 (134 residues), 84.4 bits, see alignment E=2.9e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1237)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZP4 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Atu1237 glycosyl transferase (Agrobacterium fabrum C58)
MYANASSENGAVNVSDDGPPLRIIHCFRSPVGGVFRHVRDLIEEHVRQGHKVGIVCDSST
GGAHEERLFAQITPMLELGLTRLPIRRSISPGDLLALWKSYKHIKSLRPDILHGHSAKGG
ALARLIGSLLRANRYRVARLYSPHGGSLHYARNSLKGQLFLRLERFQEHFTDALCFVCNF
EQETYETKVGKPRTRTAMIYNGVQESEFETVPPRDGAARFLYIGMLRDLKGPDVFIRAFA
KMERSIGQPMSGVIVGDGPDRDKYAAMIATAGLSRRISMHAAMPARQAFELATTVVVPSR
AEAMPYIVLEALAAGKTVIASHVGGIPEVLGEDSEALVPAGDADALARTMVKDAADADWA
QRVMPHPDSFKAKFSTPVMADEMMKLYRDLLTT