Protein Info for Atu1207 in Agrobacterium fabrum C58

Annotation: GGDEF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 55 (24 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details PF20973: VUPS" amino acids 17 to 221 (205 residues), 263 bits, see alignment E=1.8e-82 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 255 to 413 (159 residues), 128.1 bits, see alignment E=1.4e-41 PF00990: GGDEF" amino acids 258 to 411 (154 residues), 117.8 bits, see alignment E=4.1e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1207)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZR4 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Atu1207 GGDEF family protein (Agrobacterium fabrum C58)
MQWANLALFLTEAIVYFSVMTAFLHYRHILGIGVFLTALGVMHFLETYLAAVFYVQLPFG
VASPGSSILFAGKLMMILMLYMREDAAVVRQPIYGLFLGNILTVIMAQIIRFHQTVAIVP
GQSVSTGFLDEMGILMVWGTSLLYIDAIAIILFYEKLGRYLQRHIVLRFAICGVVILSFD
QAGFYGALRLLFNAPVDVFYDGWKAKMAAVGIYSLLFATYLWLTAAKGRFLTRRSVADVF
NDLTFRERYEELLSRSGRDMLTGVSDRARMELDAPSLVVECLEKRRPVSVLIVDIDHFKT
VNDTFGHLQGDEILREFAAVLKRAVQPLGHLYRFGGEEFVALLPAMTHETALAFSASLRV
AVLAELQRPDGSPLTVSIGVATAFEDGQLFRALLSEADAWLYAAKNNGRDQVHGRHGMWV
G