Protein Info for Atu1205 in Agrobacterium fabrum C58

Annotation: threonine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 TIGR02079: threonine dehydratase" amino acids 13 to 424 (412 residues), 673.3 bits, see alignment E=5.7e-207 PF00291: PALP" amino acids 27 to 319 (293 residues), 235.3 bits, see alignment E=1e-73 PF00585: Thr_dehydrat_C" amino acids 332 to 422 (91 residues), 64.9 bits, see alignment E=4.8e-22

Best Hits

Swiss-Prot: 41% identical to ILVA_BACSU: L-threonine dehydratase biosynthetic IlvA (ilvA) from Bacillus subtilis (strain 168)

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 100% identity to atu:Atu1205)

Predicted SEED Role

"Threonine dehydratase biosynthetic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.3.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZR6 at UniProt or InterPro

Protein Sequence (424 amino acids)

>Atu1205 threonine dehydratase (Agrobacterium fabrum C58)
MNFNGLTIVDKQLVEAARREVREIFPETPLQLNEHLSRRYGASIWLKREDLSPVRSYKIR
GAFNFLRKAVAKAGKDKVFVCASAGNHAQGFAFACRHFGVHGVVFMPVTTPQQKIEKTRI
FGGEFIKIRLVGDIFDQCYAAARQHVQDHDGYMVPPFDHEDIIEGQATVAAEIMDQLPEG
TKPDIVVMPVGGGGLSAGLTGFLAGTVKKENFVFCEPEGAPSLKKSLERGEPVTLNKVDN
FVDGAAVARIGDLNFKALKDFPAEQVMLIPENAICVTIIEMLNLEGVVLEPAGALSIAAL
ERLGRERLEGKTVIAVVSGGNFDFERLPDVKERAMRYTGVKKYFILRLPQRPGALRDFLN
LLGPDDDIARFEYLKKSARNFGSILIGIETNAQENFAGLLERFEAAGLGYEDITENDILS
NLII