Protein Info for Atu1197 in Agrobacterium fabrum C58

Annotation: transcriptional regulator, MerR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 1 to 126 (126 residues), 149.6 bits, see alignment E=2.4e-48 PF13411: MerR_1" amino acids 1 to 68 (68 residues), 63.1 bits, see alignment E=3.3e-21 PF00376: MerR" amino acids 2 to 39 (38 residues), 52.4 bits, see alignment 5.5e-18 PF09278: MerR-DNA-bind" amino acids 44 to 108 (65 residues), 69.7 bits, see alignment E=3.9e-23

Best Hits

Swiss-Prot: 54% identical to HMRR1_RHIME: Heavy metal-dependent transcription regulator 1 (hmrR1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to atu:Atu1197)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJE1 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Atu1197 transcriptional regulator, MerR family (Agrobacterium fabrum C58)
MNIGTAATASGVSAKMIRHYEMIGLIKSANRTDSGYRVYTANDLETLRFIRRGRDLGFSI
EKIRQLMTLWRDPGGASCDVKRIVMEHVIDLEAKMDTLREMADTLRNLATYCPDNGEPEC
PIIHDLAHAEDLEFSAVAVVPKRTGMLKGTSGPAMDLQRQAK