Protein Info for Atu1179 in Agrobacterium fabrum C58

Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 6 to 323 (318 residues), 403 bits, see alignment E=4.4e-125 PF00108: Thiolase_N" amino acids 38 to 145 (108 residues), 27 bits, see alignment E=4.4e-10 PF08545: ACP_syn_III" amino acids 107 to 190 (84 residues), 107.3 bits, see alignment E=4.5e-35 PF08541: ACP_syn_III_C" amino acids 235 to 323 (89 residues), 127.5 bits, see alignment E=2.8e-41

Best Hits

Swiss-Prot: 100% identical to FABH_AGRFC: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to agr:AGROH133_05413)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UG62 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Atu1179 3-oxoacyl-(acyl-carrier-protein) synthase III (Agrobacterium fabrum C58)
MIRSIVRGFGAALPKRVMTNSEIEGVVETSDEWIVQRTGIRQRYIAGEGETTASLGEAAA
RAALDNAGLTPADIDLIILATSTPDNTFPATAVNIQNRLGMTHGFAFDMQAVCSGFVYAV
ATADLYIRGGMAKRVLVIGAETFSRILDWKDRTTCVLFGDGAGALVIEAGEGEGTSSDRG
ILTSQLRSDGSHKDKLYVDGGPSTTGTVGHLRMEGREVFKHAVGMITDVIEQAFEATGTT
ADDLDWLVPHQANKRIIDGSAKKLNIDPEKVVITVDKHGNTSAASIPLALAVAASDGRIK
KGDLVMLEAMGGGFTWGAVLLRW