Protein Info for Atu1140 in Agrobacterium fabrum C58

Annotation: phosphoribosyalaminoimidazole-succinocarboxamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 45% identical to PUR3_HAEIN: Phosphoribosylglycinamide formyltransferase (purN) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K11175, phosphoribosylglycinamide formyltransferase 1 [EC: 2.1.2.2] (inferred from 100% identity to atu:Atu1140)

MetaCyc: 40% identical to phosphoribosylglycinamide formyltransferase 1 (Escherichia coli K-12 substr. MG1655)
Phosphoribosylglycinamide formyltransferase. [EC: 2.1.2.2]

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.2)

MetaCyc Pathways

superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CZW4 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Atu1140 phosphoribosyalaminoimidazole-succinocarboxamide synthase (Agrobacterium fabrum C58)
MVSLAKACQAADFPAEIACVISDKASAGGLEKARDLGIPTLVFERKTYASKAEHEGAILA
ALGEIAPDIICLAGYMRLISGDFIAPYEGRIINIHPSLLPLFPGLHTHQRAIDSGMKISG
CTVHFVTEGMDEGPTIAQGAVPVLSGDTAETLAARILTVEHQLYPLTLKRLAEGKVRMED
GKAVSTDNESKSEYSSLISAF