Protein Info for Atu1134 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 76 to 100 (25 residues), see Phobius details amino acids 120 to 145 (26 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 275 to 300 (26 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 15 to 291 (277 residues), 48.5 bits, see alignment E=4.6e-17

Best Hits

KEGG orthology group: K07027, (no description) (inferred from 100% identity to atu:Atu1134)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJG3 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Atu1134 hypothetical protein (Agrobacterium fabrum C58)
MKFKKYIWPVVGFATIGFSAWLLFHELRGLSLDDFWDSLKAIRVRDWLCSGLATLLAYAA
LAGYDRIALQHLGRKVNWFFITLTSFTTYALSHNVGASVFSGAVVRYRAYTSKGLSVAEV
GILVGLCSFTFLIGTIMLIGLVLLYEPDITERFTGILPVEASTTTGIVLLLFVSLYVLGS
LLRLKPLKIGSFMLPYPAPKLVAQQLVIGPIELIGAAGIIYFALPEAGNPGYMVILGIFL
VSFSAALISHAPGGLGVLELVFVTGLPDMNPADVIAALLVFRLFYLIIPFIMALFVILFF
ERSQLAQAQKREGLR