Protein Info for Atu1129 in Agrobacterium fabrum C58

Annotation: excinuclease ABC chain C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 TIGR00194: excinuclease ABC subunit C" amino acids 22 to 616 (595 residues), 558.1 bits, see alignment E=1.3e-171 PF01541: GIY-YIG" amino acids 30 to 103 (74 residues), 36.8 bits, see alignment E=1.2e-12 PF27096: UvrC_M" amino acids 114 to 210 (97 residues), 91.4 bits, see alignment E=1.4e-29 PF02151: UVR" amino acids 221 to 249 (29 residues), 37.7 bits, see alignment (E = 3.8e-13) PF22920: UvrC_RNaseH" amino acids 264 to 377 (114 residues), 134.7 bits, see alignment E=4.4e-43 PF08459: UvrC_RNaseH_dom" amino acids 394 to 570 (177 residues), 174.9 bits, see alignment E=3.5e-55 PF14520: HHH_5" amino acids 586 to 636 (51 residues), 34.2 bits, see alignment 9e-12

Best Hits

Swiss-Prot: 100% identical to UVRC_AGRFC: UvrABC system protein C (uvrC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to atu:Atu1129)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UGA9 at UniProt or InterPro

Protein Sequence (642 amino acids)

>Atu1129 excinuclease ABC chain C (Agrobacterium fabrum C58)
MDWNAGWKNESGLKGMDLIGEFVKHLPNSPGVYRMFNEAGDVLYVGKARSLKKRVGNYAQ
GRVHSNRIAQMVRFTTHMEFVTTRTETEALLLEANLIKRLRPRFNVLLRDDKSFPYILIT
ADNRAPAIFKHRGARARKGDYFGPFASAGAVGRTINSLQRAFLIRTCTDSVFETRTRPCL
LYQIKRCSGPCTHEVSDEGYAELVKEAKDFLSGKSQAVKTAIARQMNEASEDLDFERAAI
YRDRLAALSHVQSHQGINPAGIEEADVFAIHHEGGISCIQVFFFRTGQNWGNRAYFPKAD
PSLPGSEILNAFLAQFYDDKPVPKQILLSETVEEQELLAAALGEKAGHKVTISVPQRGEK
KDITDHVLANAREAHGRKLAETSSQARLLKGFAETFNLPYVPRRIEIYDNSHIMGTNAVG
GMVVAGPEGFVKNQYRKFNIKSTDITPGDDFGMMREVMTRRFSRLLKEEGKPDRAQTPTP
EEAADLPFPAWPDVILIDGGQGQMTAVRAILDELGIRDCVTAIGVAKGVDREAGRERFFA
DGRSDFSLPPRDPVLYFIQRMRDEAHRFAIGSHRARRKKEMVRNPLDEISGIGPGRKRSL
LQHFGTAKAVSRAGLNDLMTVTGISETVARQIYNHFHESGSD