Protein Info for Atu1128 in Agrobacterium fabrum C58

Annotation: phosphatidylglycerophosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 81 to 109 (29 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details TIGR00560: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase" amino acids 7 to 192 (186 residues), 161.5 bits, see alignment E=1.5e-51 PF01066: CDP-OH_P_transf" amino acids 7 to 177 (171 residues), 136.4 bits, see alignment E=5.4e-44

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 100% identity to atu:Atu1128)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJG5 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Atu1128 phosphatidylglycerophosphate synthase (Agrobacterium fabrum C58)
MASRAYNIPNLLTYARILAVPVIVLCFFIEGKLESSDFARWTALWLFIVASLTDFLDGYL
ARIWNQTSNIGRMLDPIADKLLVASVLLLMAADGTIAGWSLWAAITILCREILVSGLREY
LAALKVSVPVTQIAKWKTTIQMVAIAFLLAGPAGDKVLPYTTEMGITLLWLAAALTMYTG
YDYFKAGLKHIVDEE