Protein Info for Atu1107 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 13 to 32 (20 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 66 to 83 (18 residues), see Phobius details amino acids 100 to 125 (26 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details amino acids 339 to 357 (19 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 5 to 359 (355 residues), 267.6 bits, see alignment E=5.9e-84 PF03739: LptF_LptG" amino acids 8 to 357 (350 residues), 205.8 bits, see alignment E=5.1e-65

Best Hits

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 100% identity to atu:Atu1107)

Predicted SEED Role

"Permease, YjgP/YjgQ family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJH1 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Atu1107 hypothetical protein (Agrobacterium fabrum C58)
MIFNTLARYFLKRYLMTTIWFVLGVSSIIYLADFSETARRMSGLPGYSVPAALGLTALRL
PLILQQTVPFIALFVGMTTLISLNRRYELVVTRAAGISAWQFILPFVLGAVFIGILSVMV
LNPIAAWGQNKSLAMEAGLRNDAGGGRQQEIIPWMRQSSGGKDTIIGAKSFEDNGTMLLD
VVLIDVDKDGNIVSRKDAKSAKLEDGYWLLNGVSETRAGHVPVRQESMQISTNLRREFVQ
ERMTQTETVAFFDLSHKIEVAKSFGLSSKALETQYHFLLSTPLLLVAMTLIAATVSLKFS
RFAQSRSVILGGIVSGFVLYVVTVLVRAFGSGGVVPPTVAVWVPVIVALALGATILLHQE
DG