Protein Info for Atu1105 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF13624: SurA_N_3" amino acids 1 to 140 (140 residues), 34.5 bits, see alignment E=9.3e-13

Best Hits

KEGG orthology group: K03771, peptidyl-prolyl cis-trans isomerase SurA [EC: 5.2.1.8] (inferred from 100% identity to atu:Atu1105)

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJH3 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Atu1105 hypothetical protein (Agrobacterium fabrum C58)
MMNFGKSALRGAAFAFAIFAVPMAVVPYAGQAFADSTVKIVVNKTPITNDDIARRVAFLK
LQRQSGNLNEKAREQLVDEALKREEIARVKMSVSTQDVDAAFARFAGNNKMKPEQLTKVL
AQAGVGAEHFKAFIAVQMSWPRLVNARYGARGKMSNQDLVTRLKERGEKPVTTEYFLQQV
IFVIPEAKRNAITGKRKAEAEASRKRYPGCDQAMSFAATMRDVAIKDLGRILAPELPEDW
KALVEKTKEGGTTGTRVTEKGVEYLAICKQRQVSDDYAAEMVFKSEDLMKAKDGENPNEK
KYIEELRKKAQIVNT