Protein Info for Atu1084 in Agrobacterium fabrum C58

Annotation: replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 PF00772: DnaB" amino acids 21 to 122 (102 residues), 91 bits, see alignment E=9e-30 TIGR00665: replicative DNA helicase" amino acids 21 to 488 (468 residues), 499.6 bits, see alignment E=3.8e-154 PF03796: DnaB_C" amino acids 199 to 486 (288 residues), 336.8 bits, see alignment E=1.7e-104 PF13481: AAA_25" amino acids 203 to 390 (188 residues), 58.7 bits, see alignment E=1.3e-19

Best Hits

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 100% identity to atu:Atu1084)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJI0 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Atu1084 replicative DNA helicase (Agrobacterium fabrum C58)
MNDAVRKITPAQPAEPHYREAPNNIEAEQALLGAILVNNDAYYRVSDFLKPVHLYEPLHR
KIFEVAGDIIRMGKTANPVTIKTFLPADDKIGDLTVAQYLARLAAEAVSIINAEDYGRAI
YDLALRRALIQIGEDVVNIAYDAPLDMPPQAQIEDTERRLFELAETGRYDGGFQSFNDAV
ALAIDMAGAAFERDGNLSGISTGIHSLDGRMGGLQRSDLIVLAGRPGMGKTSLATNIAYN
IAASYEQEVQPDGSFKAKNGGVVGFYSLEMSSEQLATRIISEQTEVSSSKIRRGDITEAD
FEKLIACSQMMQKVPLYIDQTGGISIAQLSARARRLKRQRGLDVLVVDYIQLMTGAGKSG
ENRVQEITQITTGLKALGKELNVPIIALSQLSRAVENREDKRPQLSDLRESGSIEQDADV
VLFVFREEYYVKNMEPRDISDPKYAEWEALFDKVKGTADVIIAKQRHGPTGTVKLAFQSE
FTRFADLADPSFTQYEEH