Protein Info for Atu1080 in Agrobacterium fabrum C58

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 TIGR00492: alanine racemase" amino acids 24 to 387 (364 residues), 220.7 bits, see alignment E=1.4e-69 PF01168: Ala_racemase_N" amino acids 26 to 237 (212 residues), 189.4 bits, see alignment E=7.6e-60 PF00842: Ala_racemase_C" amino acids 250 to 386 (137 residues), 120.5 bits, see alignment E=3.6e-39

Best Hits

Swiss-Prot: 100% identical to ALR1_AGRFC: Alanine racemase, biosynthetic (alr) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 100% identity to atu:Atu1080)

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.1

Use Curated BLAST to search for 5.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P58736 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Atu1080 alanine racemase (Agrobacterium fabrum C58)
MTDDFEDSFPDNETDAFEQAPLRLTVDLGALADNWRDMKKRSGRARTAAVVKADAYGLGI
EDCGATLYHAGARDFFVATVAEGATLRSYAPEARIFVLSGIWQGQERQVFDNDLVPVLAS
EEQLSFWMATVAERGDHPCALHVDTGFNRLGLPLDDALFLADDVTRPASFDPVLVLSHLA
CADTPSSPMNRAQLESFRRVSAAFEGIESSLSASAGIFLGPDYHFDLTRPGIALYGGEAV
NDVANPMRPVAKAEARIIQIREAGEGQTVSYGSSFLLKRASRLAIASVGYADGYQRSLSG
SGIPLREMGHGGAYGVVNGHKVPVAGRVTMDLTIFDVTDVPANAIRAGDYIELFGPNVPV
DETARAAGTIGYEMLTGLGLRYERQYLVADD