Protein Info for Atu1073 in Agrobacterium fabrum C58

Annotation: cysteinyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 TIGR00435: cysteine--tRNA ligase" amino acids 5 to 447 (443 residues), 440.3 bits, see alignment E=5.1e-136 PF01406: tRNA-synt_1e" amino acids 18 to 331 (314 residues), 374.6 bits, see alignment E=6e-116 PF23493: CysS_C" amino acids 406 to 448 (43 residues), 24.4 bits, see alignment 3.8e-09

Best Hits

Swiss-Prot: 100% identical to SYC_AGRFC: Cysteine--tRNA ligase (cysS) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 100% identity to atu:Atu1073)

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UGG4 at UniProt or InterPro

Protein Sequence (461 amino acids)

>Atu1073 cysteinyl-tRNA synthetase (Agrobacterium fabrum C58)
MSLRLKLHNTLTREKSEFAPIDADNVRMYVCGPTVYDFAHIGNARPVIVFDVLFRLLRHV
YGEDHVTYARNITDLDDKINARALRDYPHLPLNDAIHAVTKKTADQFHDDVAALGCLQPT
VEPRATDYIAEMIYLIERLIERGHAYKAGGEVLFDTRSMADYGQLSKRPLDEQQAGARVA
VEAHKKNPGDFVLWKLSSESEPGWESPWGLGRPGWHIECSAMAGRYLGEVFDIHGGGLDL
IFPHHENEIAQSRCAHGTHVMANVWMHNGFVQVEGRKMSKSEGNFVTIYELLHTDKFGGR
QWPGEVLRLAMLMTHYREPIDFSVKRLEEAERLLSKWPAAETSDAAADETVLEALADDLN
TVAAVQALHALAHAANTDPSRLPAFAASAALLGVLPKKTEMDEAIVSAVDALVELRLEML
KAKNFAEADRLRDELSEKGIQLKDGKDKETGERTTTWELKR