Protein Info for Atu1069 in Agrobacterium fabrum C58

Annotation: proline iminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR01249: prolyl aminopeptidase" amino acids 13 to 315 (303 residues), 397.2 bits, see alignment E=2.3e-123 PF00561: Abhydrolase_1" amino acids 42 to 299 (258 residues), 115 bits, see alignment E=7.1e-37 PF12697: Abhydrolase_6" amino acids 42 to 299 (258 residues), 46.4 bits, see alignment E=1.2e-15 PF12146: Hydrolase_4" amino acids 65 to 299 (235 residues), 42.8 bits, see alignment E=6.1e-15

Best Hits

Swiss-Prot: 61% identical to PIP_SERMA: Proline iminopeptidase (pip) from Serratia marcescens

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 100% identity to atu:Atu1069)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJI8 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Atu1069 proline iminopeptidase (Agrobacterium fabrum C58)
MTEELRGFYPEIEPFETGMLDVGDGHVIYWERVGTRGAKPAVFLHGGPGGGVNPTHRRVF
DPALYDVILFDQRGCGRSTPHAALEANTTWHLVADIERLRELCGFEKWLVFGGSWGSTLA
LAYAETHPDRVSELVLRGIYTVTRPELDWYYQFGVSEMYPDHWERFIAPIPEGERGEMMQ
AYNRYLTGADEAKKLECAKAWSQWEGATIALVTDPSRVDDFGEDKYAIAFARIENHFFVN
DCWLEEEQLLRNAGRLKDIPGAIVHGRYDMPCPLKYAWQLAKAWPKADFHIIEAAGHALS
EPGILDQLIRANDRFAGK