Protein Info for Atu1062 in Agrobacterium fabrum C58

Annotation: phosphatidylserine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 59 to 75 (17 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 220 to 236 (17 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 34 to 193 (160 residues), 85.2 bits, see alignment E=6.4e-28 TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase" amino acids 40 to 205 (166 residues), 110.8 bits, see alignment E=3.3e-36 PF08009: CDP-OH_P_tran_2" amino acids 220 to 255 (36 residues), 29.8 bits, see alignment 4.7e-11

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 100% identity to atu:Atu1062)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D020 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Atu1062 phosphatidylserine synthase (Agrobacterium fabrum C58)
METPISEPQQNGKQEGRSDSGRGPRLREIPFRLLVPNLITVLAICAGLSGVRLAIEGRFE
LAVGMVLLAAFLDGVDGRVARMMKATSKFGEQMDSLADIVNFGVAPALVVYIYLLDQARS
IGWIGALIYVIAAGLRLARFNVMIERPVKAPWQSEFFVGVPAPMGAMLVLLPVYLGFLGV
EPDKPFAYVAAAYTVLIGYLLISRLPVWSGKSSTRIRRDLVLPMILVVVLYVAMLMSFTW
EVLVLTVAAYLVFIPISARLWHRRYGTLTIEEDAHDDANGGNGLDRGI