Protein Info for Atu1060 in Agrobacterium fabrum C58

Annotation: two component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 PF00072: Response_reg" amino acids 5 to 104 (100 residues), 36.3 bits, see alignment E=5.8e-13 amino acids 126 to 238 (113 residues), 82.9 bits, see alignment E=1.8e-27 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 252 to 414 (163 residues), 136.7 bits, see alignment E=3.1e-44 PF00990: GGDEF" amino acids 256 to 412 (157 residues), 130.2 bits, see alignment E=6.2e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1060)

Predicted SEED Role

"FIG00985728: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D021 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Atu1060 two component response regulator (Agrobacterium fabrum C58)
MQDKILLIEDSVALSMLLRTRLSDETEAEVVHCASMAEADALMQANNFTLALTGLNLPDA
PKGEILTLLSERKVPAIVFTATVDEEARKRYAEKKIIDYIVKDGHRTVDAVVKTVDRIMT
NKRFSVLVVDDARTARSGLVEILERQNFKVSEAHSGNRALEILSQDPSIQLVITDYHMPD
MDGYELTRRIRDSRSSEDLRVIGISSSTDRLLSASFLKAGASDFVYRPFVPEELQCRIDN
NIETLKQLKRLRELAERDHLTGLPNRRSFFERTRALMDVINDNDESGAVAILDIDHFKKI
NDTLGHDAGDRALKKLAELLQGMCDEQRHIPARLGGEEFAVFLRGLDARAAYAFCEELRE
QVEKNGRQLSGSSLALTISLGVVEIEKGEPFDNQLNAADQLLYLAKANGRNRVYSDIMIQ
EGLQKIGLNG